Structure of PDB 6ryd Chain F Binding Site BS02

Receptor Information
>6ryd Chain F (length=58) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RWTPTTEQIKILKELYYNNAIRSPTADQIQKITARLRQFGKIEGKNVFYW
FQNHKARE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ryd Structural basis for the complex DNA binding behavior of the plant stem cell regulator WUSCHEL.
Resolution1.575 Å
Binding residue
(original residue number in PDB)		R38 S60 Q89 K92
Binding residue
(residue number reindexed from 1)		R1 S23 Q52 K55
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0099402 plant organ development

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6ryd, PDBe:6ryd, PDBj:6ryd
PDBsum6ryd
PubMed32376862
UniProtQ9SB92|WUS_ARATH Protein WUSCHEL (Gene Name=WUS)

[Back to BioLiP]