Structure of PDB 6pmi Chain F Binding Site BS02

Receptor Information
>6pmi Chain F (length=239) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NSLYTAEGVMDKHSLWQRYVPLVRHEALRLQVRLPASVELDDLLQAGGIG
LLNAVERYDALQGTAFTTYAVQRIRGAMLDELRSRDWVPRSVRRNAREVA
QAIGQLEQELGRNATETEVAERLGIDIADYRQMLLDTNNSQLFSYDEWRE
EHGDSIELVTDDHQRENPLQQLLDSNLRQRVMEAIETLPEREKLVLTLYY
QEELNLKEIGAVLEVGESRVSQLHSQAIKRLRTKLGKLL
Ligand information
>6pmi Chain 2 (length=54) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgccgcaaacaagttgtagagcttatcggcaaggaggaaggaaactttat
tgct
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6pmi Structural basis of bacterial sigma28-mediated transcription reveals roles of the RNA polymerase zinc-binding domain.
Resolution3.86 Å
Binding residue
(original residue number in PDB)		V33 R34 L35 L80 L83 R84 R94 R95 R98 L143 E148 W149 R150 E151 K208 E218
Binding residue
(residue number reindexed from 1)		V32 R33 L34 L79 L82 R83 R93 R94 R97 L142 E147 W148 R149 E150 K207 E217
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0003899 DNA-directed 5'-3' RNA polymerase activity
GO:0005515 protein binding
GO:0016987 sigma factor activity
Biological Process
GO:0006351 DNA-templated transcription
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription
GO:0010468 regulation of gene expression
GO:0044780 bacterial-type flagellum assembly
GO:0071973 bacterial-type flagellum-dependent cell motility
GO:2000142 regulation of DNA-templated transcription initiation
Cellular Component
GO:0000345 cytosolic DNA-directed RNA polymerase complex
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6pmi, PDBe:6pmi, PDBj:6pmi
PDBsum6pmi
PubMed32484956
UniProtP0AEM6|FLIA_ECOLI RNA polymerase sigma factor FliA (Gene Name=fliA)

[Back to BioLiP]