Structure of PDB 6o09 Chain F Binding Site BS02

Receptor Information
>6o09 Chain F (length=262) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LYFQGMLELRLVQGSLLKKVLESIKDLVNDANFDCSSTGFSLQAMDSSHV
ALVSLLLRSEGFEHYRCDRNLSMGMNLGNMSKMLKCAGNDDIITIKADDG
GDTVTFMFESPTQDKIADFEMKLMDIDSEHLGIPDAEYHSIVRMPSNEFS
RICKDLSSIGDTVVISVTKEGVKFSTAGDIGTANIVLRQNTTVKPEDAIV
IEMKEPVSLSFALRYMNSFTKATPLSDTVTISLSSELPVVVEYKVAEMGY
IRYYLAPKIEEE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6o09 ATXR5/6 Forms Alternative Protein Complexes with PCNA and the Nucleosome Core Particle.
Resolution2.06 Å
Binding residue
(original residue number in PDB)		Q-1 G95 G96
Binding residue
(residue number reindexed from 1)		Q4 G100 G101
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030337 DNA polymerase processivity factor activity
Biological Process
GO:0006260 DNA replication
GO:0006275 regulation of DNA replication
GO:0051726 regulation of cell cycle
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6o09, PDBe:6o09, PDBj:6o09
PDBsum6o09
PubMed30826376
UniProtQ9M7Q7|PCNA1_ARATH Proliferating cellular nuclear antigen 1 (Gene Name=PCNA)

[Back to BioLiP]