Structure of PDB 6mtd Chain F Binding Site BS02

Receptor Information

>6mtd Chain F (length=225) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NFAELKIKRLRKKFAQKMLRKARRKLIYEKAKHYHKEYRQMYRTEIRMAR
MARKAGNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFV
KLNKASINMLRIVEPYIAWGYPNLKSVNELIYKRGYGKINKKRIALTDNT
LIARSLGKYNIICMEDLIHEIYTVGKHFKEANNFLWPFKLSSPRGGMKKK
TTHFVEGGDAGNREDQINRLIRRMN

Ligand information

>6mtd Chain 7 (length=120) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gucuacggccauaccacccugaacgcgcccgaucucgucugaucucggaa
gcuaagcagggucgggccugguuaguacuuggaugggagaccgccuggga
auaccgggugcuguaggcuu

<<<<<<<<<....<<<<<<<<.....<<<<<..............>>>..
>>....>>>>>>.>><<<<<<<.....<<.<<..<<....>>.>>.>>..
..>>>>>>>>>>>>>>>>..

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6mtd Structures of translationally inactive mammalian ribosomes.
Resolution	3.3 Å
Binding residue (original residue number in PDB)	R133 E136 K221 T223 T224
Binding residue (residue number reindexed from 1)	R111 E114 K199 T201 T202

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000463	maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6mtd, PDBe:6mtd, PDBj:6mtd
PDBsum	6mtd
PubMed	30355441
UniProt	G1SV32\|RL7_RABIT Large ribosomal subunit protein uL30 (Gene Name=RPL7)

[Back to BioLiP]