Structure of PDB 6m7j Chain F Binding Site BS02

Receptor Information
>6m7j Chain F (length=319) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SEALRQARKDAELTASADSVRAYLKQIGKVALLNAEEEVELAKRIEAGLY
ATQLMTELSERGEKLPAAQRRDMMWICRDGDRAKNHLLEANLRLVVSLAK
RYTGRGMAFLDLIQEGNLGLIRAVEKFDYTKGYKFSTYATWWIRQAITRA
MADQARTIRIPVHMVEVINKLGRIQRELLQDLGREPTPEELAKEMDITPE
KVLEIQQYAREPISLDQTIGDEGDSQLGDFIEDSEAVVAVDAVSFTLLQD
QLQSVLDTLSEREAGVVRLRFGLTDGQPRTLDEIGQVYGVTRERIRQIES
KTMSKLRHPSRSQVLRDYL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6m7j Structures of an RNA polymerase promoter melting intermediate elucidate DNA unwinding.
Resolution4.4 Å
Binding residue
(original residue number in PDB)		E374 R478 T488 L489 R500 E501 R504
Binding residue
(residue number reindexed from 1)		E166 R270 T280 L281 R292 E293 R296
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
GO:0016987 sigma factor activity
Biological Process
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription
GO:0009415 response to water
GO:0010468 regulation of gene expression
GO:2000142 regulation of DNA-templated transcription initiation
Cellular Component
GO:0005737 cytoplasm
GO:0005886 plasma membrane
GO:0009274 peptidoglycan-based cell wall

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6m7j, PDBe:6m7j, PDBj:6m7j
PDBsum6m7j
PubMed30626968
UniProtP9WGI1|SIGA_MYCTU RNA polymerase sigma factor SigA (Gene Name=sigA)

[Back to BioLiP]