Structure of PDB 6ler Chain F Binding Site BS02

Receptor Information
>6ler Chain F (length=79) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYT
EHAKRKTVTAMDVVYALKRQGRTLYGFGG
Ligand information
>6ler Chain J (length=169) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgttttttttttgcatgtgccggtctcacacgtgcctggagactagtaag
cgcttctagtggcggttaaaacgcggtagacagcgcgtacgtgcgtttaa
gcggtgctagagctgtctacgaccaattgagcggcctcggcaccgggatg
ctgttttttttttgggtac
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ler Engineering nucleosomes for generating diverse chromatin assemblies.
Resolution3.0 Å
Binding residue
(original residue number in PDB)
T30 P32 R36 R45
Binding residue
(residue number reindexed from 1)
T7 P9 R13 R22
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
GO:0032200 telomere organization
GO:0045653 negative regulation of megakaryocyte differentiation
GO:0061644 protein localization to CENP-A containing chromatin
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0000786 nucleosome
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0016020 membrane
GO:0032991 protein-containing complex
GO:0043505 CENP-A containing nucleosome
GO:0070062 extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6ler, PDBe:6ler, PDBj:6ler
PDBsum6ler
PubMed33590100
UniProtP62805|H4_HUMAN Histone H4 (Gene Name=H4C1)

[Back to BioLiP]