Structure of PDB 6l6y Chain F Binding Site BS02

Receptor Information
>6l6y Chain F (length=80) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSFTSRIRRPMNAFMVWAKDERKRLAQQNPDLHNAELSKMLGKSWKALTL
AEKRPFVEEAKRLRVQHMQDHPNYKYRPRR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6l6y DeepCrystal: a deep learning framework for sequence-based protein crystallization prediction.
Resolution3.0 Å
Binding residue
(original residue number in PDB)
R67 R69 R70 M72 M76 R83 N95 Y137
Binding residue
(residue number reindexed from 1)
R6 R8 R9 M11 M15 R22 N34 Y76
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6l6y, PDBe:6l6y, PDBj:6l6y
PDBsum6l6y
PubMed
UniProtQ61473|SOX17_MOUSE Transcription factor SOX-17 (Gene Name=Sox17)

[Back to BioLiP]