Structure of PDB 6jxd Chain F Binding Site BS02

Receptor Information
>6jxd Chain F (length=87) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENV
IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Ligand information
>6jxd Chain J (length=147) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
catatatgccggtctcacacgtgcctggagactagtaagcgcttctagtg
gcggttaaaacgcggtagacagcgcgtacgtgcgtttaagcggtgctaga
gctgtctacgaccaattgagcggcctcggcaccgggatatatggtac
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6jxd PARP1 exhibits enhanced association and catalytic efficiency with gamma H2A.X-nucleosome.
Resolution2.25 Å
Binding residue
(original residue number in PDB)
T30 P32 R36 R45
Binding residue
(residue number reindexed from 1)
T15 P17 R21 R30
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity

View graph for
Molecular Function
External links
PDB RCSB:6jxd, PDBe:6jxd, PDBj:6jxd
PDBsum6jxd
PubMed31848352
UniProtP62805|H4_HUMAN Histone H4 (Gene Name=H4C1)

[Back to BioLiP]