Structure of PDB 6jcy Chain F Binding Site BS02

Receptor Information
>6jcy Chain F (length=164) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DEELTARFERDAIPLLDQLYGGALRMTRNPADAEDLLQETMVKAYAGFRS
FRHGTNLKAWLYRILTNTYINSYRRRARIRMEALPEDYDRVPADEPNPEQ
IYHDARLGPDLQAALQALPEEFRMAVYYADVEGFPYKEIAEIMDTPIGTV
MSRLHRGRRQLRGL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6jcy Structures and mechanism of transcription initiation by bacterial ECF factors.
Resolution3.106 Å
Binding residue
(original residue number in PDB)		E103 R111
Binding residue
(residue number reindexed from 1)		E82 R90
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0016987 sigma factor activity
Biological Process
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6jcy, PDBe:6jcy, PDBj:6jcy
PDBsum6jcy
PubMed31131408
UniProtP9WGG7;
P9WGH9|SIGH_MYCTU ECF RNA polymerase sigma factor SigH (Gene Name=sigH)

[Back to BioLiP]