Structure of PDB 6ha8 Chain F Binding Site BS02

Receptor Information

>6ha8 Chain F (length=176) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NRLKEKYNKEIAPALMTKFNYDSVMQVPKIEKIVINMGVGDAVQNAKAID
SAVEELTFIAGQKPVVTRAKKSIAGFRLREGMPIGAKVTLRGERMYDFLD
KLISVSLPRVRDFRGVSKKSFDGRGNYTLGIKEQLIFPEIDYDKVTKVRG
MDIVIVTTANTDEEARELLTQVGMPF

Ligand information

>6ha8 Chain B (length=112) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ugguggcgauagcgaagaggucacacccguucccauaccgaacacggaag
uuaagcucuucagcgccgaugguagucggggguuucccccugugagagua
ggacgccgccaa

<<<<<<<....<<<<<<<<.....<<<<<...............>>>..>
>....>>>>>>.>>.<<.......<<.<<<<<...>>>>>.>>.......
>>..>>>>>>>.

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6ha8 Structural basis for antibiotic resistance mediated by theBacillus subtilisABCF ATPase VmlR.
Resolution	3.5 Å
Binding residue (original residue number in PDB)	S24 V25 M26 Q27 K30 Q63 K64 V66 K88 T90 R92
Binding residue (residue number reindexed from 1)	S23 V24 M25 Q26 K29 Q62 K63 V65 K87 T89 R91

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6ha8, PDBe:6ha8, PDBj:6ha8
PDBsum	6ha8
PubMed	30126986
UniProt	P12877\|RL5_BACSU Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]