Structure of PDB 6cuu Chain F Binding Site BS02

Receptor Information

>6cuu Chain F (length=346) Species: 262724 (Thermus thermophilus HB27)

SDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLI
REVVRAKILGSARVRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYLHIA
REGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKF
EYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQ
LQQELGREPTYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETPIGDEKDS
FYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLID
GREHTLEEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD

Ligand information

>6cuu Chain H (length=22)

tataatgggagcctctgatgca

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6cuu Mode of Action of Kanglemycin A, an Ansamycin Natural Product that Is Active against Rifampicin-Resistant Mycobacterium tuberculosis.
• Resolution: 2.994 Å
• Binding residue (original residue number in PDB): D79 V81 R82 L85 G89 N191 R193 L194 S197 F209 K226 F227 E228 R231 F233 K234 S236 T237 Y238 T240 W241
• Binding residue (residue number reindexed from 1): D2 V4 R5 L8 G12 N114 R116 L117 S120 F132 K149 F150 E151 R154 F156 K157 S159 T160 Y161 T163 W164

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0016987 sigma factor activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006352 DNA-templated transcription initiation
• GO:0006355 regulation of DNA-templated transcription
• GO:0010468 regulation of gene expression
• GO:2000142 regulation of DNA-templated transcription initiation

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:6cuu, PDBe:6cuu, PDBj:6cuu
• PDBsum: 6cuu
• PubMed: 30244835
• UniProt: Q5SKW1