Structure of PDB 5x07 Chain F Binding Site BS02

Receptor Information

>5x07 Chain F (length=85) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GPHAKPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQ
NSIRHSLSFNDCFLKVPRSPDKPGKGSFWTLHPDS

Ligand information

>5x07 Chain E (length=16) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

caaaatgtaaacaaga

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5x07 Structure of the Forkhead Domain of FOXA2 Bound to a Complete DNA Consensus Site
Resolution	2.796 Å
Binding residue (original residue number in PDB)	S163 Y164 I165 R202 N205 S206 H209
Binding residue (residue number reindexed from 1)	S9 Y10 I11 R48 N51 S52 H55
Binding affinity	PDBbind-CN: Kd=105nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity
GO:0043565	sequence-specific DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:5x07, PDBe:5x07, PDBj:5x07
PDBsum	5x07
PubMed	28644006
UniProt	Q9Y261\|FOXA2_HUMAN Hepatocyte nuclear factor 3-beta (Gene Name=FOXA2)

[Back to BioLiP]