Structure of PDB 5wc9 Chain F Binding Site BS02

Receptor Information
>5wc9 Chain F (length=132) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DSPEIRELEKFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFE
NLQLSFKNACKLKAILSKWLEEAEQRRTTISIAAKDALERHFGEQNKPSS
QEIMRMAEELNLEKEVVRVWFCNRRQREKRVK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5wc9 Biochemical and structural characterization of a novel cooperative binding mode by Pit-1 with CATT repeats in the macrophage migration inhibitory factor promoter.
Resolution3.15 Å
Binding residue
(original residue number in PDB)		F42 S43 T45 T46 R49 S56 N59 R94 R95 Q144
Binding residue
(residue number reindexed from 1)		F41 S42 T44 T45 R48 S55 N58 R76 R77 Q126
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5wc9, PDBe:5wc9, PDBj:5wc9
PDBsum5wc9
PubMed29186613
UniProtP28069|PIT1_HUMAN Pituitary-specific positive transcription factor 1 (Gene Name=POU1F1)

[Back to BioLiP]