Structure of PDB 5v7q Chain F Binding Site BS02

Receptor Information
>5v7q Chain F (length=170) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KERYRSEIRDALRKQFGYGNVMQIPTVTKVVVNMGVGEAARDAKLINGAV
NDLALITGQKPEVRRARKSIAQFKLREGMPVGVRVTLRGDRMWEFLDRLT
SIALPRIRDFRGLSPKQFDGVGNYTFGLAEQAVFHEVDVDKIDRVRGMDI
NVVTSAATDDEGRALLRALG
Ligand information
>5v7q Chain B (length=115) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuacggcggccacagcggcagggaaacgcccggucccauuccgaacccgg
aagcuaagccugccagcgccgaugauacugccccuccggguggaaaagua
ggacaccgccgaaca
.<.<<<<<<.....<<<<<<<<.....<<<<<...............>>>
..>>....>>>>>>.>>.<<........<<<<<....>>>>>........
>>...>>>>>>.>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5v7q Structural insights into species-specific features of the ribosome from the human pathogen Mycobacterium tuberculosis.
Resolution3.7 Å
Binding residue
(original residue number in PDB)
N31 M33 Q34 Q70 K71 E73 V74 R75 T97 R99 R102
Binding residue
(residue number reindexed from 1)
N20 M22 Q23 Q59 K60 E62 V63 R64 T86 R88 R91
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0005886 plasma membrane
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5v7q, PDBe:5v7q, PDBj:5v7q
PDBsum5v7q
PubMed28977617
UniProtP9WH83|RL5_MYCTU Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]