Structure of PDB 5odn Chain F Binding Site BS02

Receptor Information
>5odn Chain F (length=105) Species: 309807 (Salinibacter ruber DSM 13855) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MARGVNKVILIGNLGDDPELRYTGSGTAVCNMSLATNETYTDEVQNTEWH
DVVAWGRLGEICNEYLDKGSQVYFEGKLQTRSWEDRDNNTRYSTEVKAQE
MMFLD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5odn Single-strand binding protein
Resolution2.598 Å
Binding residue
(original residue number in PDB)		E47 V48
Binding residue
(residue number reindexed from 1)		E43 V44
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003697 single-stranded DNA binding
Biological Process
GO:0006260 DNA replication
GO:0006281 DNA repair
GO:0006310 DNA recombination
GO:0051096 positive regulation of helicase activity
Cellular Component
GO:0009295 nucleoid

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5odn, PDBe:5odn, PDBj:5odn
PDBsum5odn
PubMed
UniProtQ2S565

[Back to BioLiP]