Structure of PDB 5gmk Chain F Binding Site BS02

Receptor Information

>5gmk Chain F (length=115) Species: 559292 (Saccharomyces cerevisiae S288C)

SERKAINKYYPPDYNPLEAEKLSRKMAKKLKTMNKSHASIRLMTPFSMRC
LECNEYIPKSRKFNGKKELLKEKYLDSIKIYRLTISCPRCANSIAFRTDP
GNSDYVMEVGGVRNY

Ligand information

>5gmk Chain L (length=127)

acgaaucucuuugccuuuuggcuuagaucaaguguaguaucuguucuuug
uaacaacuaaugaccucagaggcucaauuuguuacaauacauuuuuuggc
accgcgacccucgcacuuguggagucg

................................................<<
<<<<<<.<...<.<<<<.>>>>.>..>.>>>>>>>>..............
..<<...<<...........>>...>>

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5gmk Structure of a yeast catalytic step I spliceosome at 3.4 angstrom resolution
• Resolution: 3.4 Å
• Binding residue (original residue number in PDB): K5 K9
• Binding residue (residue number reindexed from 1): K4 K8

Gene Ontology

Molecular Function

• GO:0000384 first spliceosomal transesterification activity
• GO:0005515 protein binding
• GO:0030620 U2 snRNA binding
• GO:0046872 metal ion binding

Biological Process

• GO:0000349 generation of catalytic spliceosome for first transesterification step
• GO:0000350 generation of catalytic spliceosome for second transesterification step
• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing

Cellular Component

• GO:0005634 nucleus
• GO:0005681 spliceosomal complex
• GO:0071006 U2-type catalytic step 1 spliceosome
• GO:0071007 U2-type catalytic step 2 spliceosome

External links

• PDB: RCSB:5gmk, PDBe:5gmk, PDBj:5gmk
• PDBsum: 5gmk
• PubMed: 27445308
• UniProt: P28320|YJU2_YEAST Splicing factor YJU2 (Gene Name=YJU2)