Structure of PDB 5akn Chain F Binding Site BS02

Receptor Information
>5akn Chain F (length=184) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ENVSGISAYLLGLIIGDGGLYKLKYKGNRSEYRVVITAKSENLIKQHIAP
LMQFLIDELNVKSKIQIVKGDTRYELRVSSKKLYYYFANMLERIRLFNMR
EQIAFIKGLYVAEGDMTLKRLRIWNKNKALLEIVSRWLNNLGVRNTIHLD
DHRHGVYVLNISLRDRIKFVHTILSSHLNPLPPE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5akn Engineering a Nickase on the Homing Endonuclease I-Dmoi Scaffold.
Resolution2.75 Å
Binding residue
(original residue number in PDB)
G20 G22 Y25 Y29 N32 R33 S34 E35 Y36 R37 S67 K68 Q70 R77 R81 S83 S84 K85 E117 W128 N129 K130 D155 V160
Binding residue
(residue number reindexed from 1)
G16 G18 Y21 Y25 N28 R29 S30 E31 Y32 R33 S63 K64 Q66 R73 R77 S79 S80 K81 E113 W124 N125 K126 D151 V156
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
Biological Process
GO:0006314 intron homing
GO:0016539 intein-mediated protein splicing

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:5akn, PDBe:5akn, PDBj:5akn
PDBsum5akn
PubMed26045557
UniProtP21505|DMO1_DESMO Homing endonuclease I-DmoI

[Back to BioLiP]