Structure of PDB 5aiy Chain F Binding Site BS02

Receptor Information
>5aiy Chain F (length=30) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Ligand information
>5aiy Chain E (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GIVEQCCTSICSLYQLENYCN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5aiy Unraveling the symmetry ambiguity in a hexamer: calculation of the R6 human insulin structure.
ResolutionN/A
Binding residue
(original residue number in PDB)		Q4 C7 V18 C19 R22 G23 F24 Y26 T30
Binding residue
(residue number reindexed from 1)		Q4 C7 V18 C19 R22 G23 F24 Y26 T30
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:5aiy, PDBe:5aiy, PDBj:5aiy
PDBsum5aiy
PubMed10723989
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]