Structure of PDB 4xzq Chain F Binding Site BS02

Receptor Information
>4xzq Chain F (length=79) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYT
EHAKRKTVTAMDVVYALKRQGRTLYGFGG
Ligand information
>4xzq Chain J (length=147) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagatactaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagctggattccagctgaacatgccttttgatgga
gcagtttccaaatacacttttggtagtatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4xzq Histone Acetylation near the Nucleosome Dyad Axis Enhances Nucleosome Disassembly by RSC and SWI/SNF.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		T230 R236 R245
Binding residue
(residue number reindexed from 1)		T7 R13 R22
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity

View graph for
Molecular Function
External links
PDB RCSB:4xzq, PDBe:4xzq, PDBj:4xzq
PDBsum4xzq
PubMed26416878
UniProtP62799|H4_XENLA Histone H4

[Back to BioLiP]