Structure of PDB 4wk8 Chain F Binding Site BS02

Receptor Information
>4wk8 Chain F (length=80) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RPPFTYATLIRWAILEAPEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIR
HNLSLHKCFVRVESEKGAVWTVDELEFRKK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4wk8 DNA binding by FOXP3 domain-swapped dimer suggests mechanisms of long-range chromosomal interactions.
Resolution3.4006 Å
Binding residue
(original residue number in PDB)		P378 N383 H387
Binding residue
(residue number reindexed from 1)		P42 N47 H51
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4wk8, PDBe:4wk8, PDBj:4wk8
PDBsum4wk8
PubMed25567984
UniProtQ9BZS1|FOXP3_HUMAN Forkhead box protein P3 (Gene Name=FOXP3)

[Back to BioLiP]