Structure of PDB 4s04 Chain F Binding Site BS02

Receptor Information
>4s04 Chain F (length=219) Species: 1380908 (Klebsiella pneumoniae JM45) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKILVIEDDALLLQGLILAMQSEGYVCDGVSTAHEAALSLASNHYSLIVL
DLGLPDEDGLHFLSRMRREKMTQPVLILTARDTLEDRISGLDTGADDYLV
KPFALEELNARIRALLRRHNNQGDNEISVGNLRLNVTRRLVWLGETALDL
TPKEYALLSRLMMKAGSPVHREILYNDIYSGDNEPATNTLEVHIHNLREK
IGKSRIRTVRGFGYMLANN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4s04 Structure and dynamics of polymyxin-resistance-associated response regulator PmrA in complex with promoter DNA.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		E191 H195 T208 R210 G211 Y214
Binding residue
(residue number reindexed from 1)		E191 H195 T208 R210 G211 Y214
Binding affinityPDBbind-CN: Kd=200.6nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000156 phosphorelay response regulator activity
GO:0000976 transcription cis-regulatory region binding
GO:0003677 DNA binding
GO:0046872 metal ion binding
Biological Process
GO:0000160 phosphorelay signal transduction system
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005829 cytosol
GO:0032993 protein-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4s04, PDBe:4s04, PDBj:4s04
PDBsum4s04
PubMed26564787
UniProtA0A0R4I965

[Back to BioLiP]