Structure of PDB 4p3w Chain F Binding Site BS02

Receptor Information
>4p3w Chain F (length=157) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HCLSLKIMTAQVTSPSGKTHEAEIHTYCIRFVPAEMGTHTVSVKYKGQHV
PGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGL
AIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPF
VVPVASP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4p3w Crystal structure of the human filamin A Ig-like domains 20-21 in complex with migfilin peptide
Resolution2.0 Å
Binding residue
(original residue number in PDB)		M2207 G2208 A2268 G2269 G2270 L2271 A2272 I2273 A2274 V2275 E2276 G2277 P2278 K2280 A2281 F2285
Binding residue
(residue number reindexed from 1)		M36 G37 A97 G98 G99 L100 A101 I102 A103 V104 E105 G106 P107 K109 A110 F114
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0051015 actin filament binding
Biological Process
GO:0030036 actin cytoskeleton organization

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4p3w, PDBe:4p3w, PDBj:4p3w
PDBsum4p3w
PubMed
UniProtP21333|FLNA_HUMAN Filamin-A (Gene Name=FLNA)

[Back to BioLiP]