Structure of PDB 4m9v Chain F Binding Site BS02

Receptor Information
>4m9v Chain F (length=60) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PSERPFFCNFCGKTYRDASGLSRHRRAHLGYRPRSCPECGKCFRDQSQVN
RHLKVHQNKP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4m9v DNA recognition of 5-carboxylcytosine by a zfp57 mutant at an atomic resolution of 0.97 angstrom.
Resolution0.969 Å
Binding residue
(original residue number in PDB)		R138 Y149 R150 D151 S153 R166 K175 R178 Q182 R185 H186 V189
Binding residue
(residue number reindexed from 1)		R4 Y15 R16 D17 S19 R32 K41 R44 Q48 R51 H52 V55
Binding affinityPDBbind-CN: Kd=7nM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4m9v, PDBe:4m9v, PDBj:4m9v
PDBsum4m9v
PubMed24236546
UniProtQ8C6P8|ZFP57_MOUSE Zinc finger protein 57 (Gene Name=Zfp57)

[Back to BioLiP]