Structure of PDB 4l62 Chain F Binding Site BS02

Receptor Information

>4l62 Chain F (length=187) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DTRQHLLDTGYRIMAVKGFSGVGLNEILQSAGVPKGSFYHYFKSKEQFGQ
ALLEDYFRVYLADMDQRFSAPGLNARERLMSYWQKWLDNACPPCDEQRCL
VVKLSAEVADLSESMRITLRDGSDGIIERLVGCLGQGRDDGSLAPCDARH
MASALYQLWLGASLLSKLHRSPGPLETAMQTTRSLLE

Ligand information

>4l62 Chain T (length=25) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tgaattagaccagtcgtctagaaac

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4l62 Crystal structure of Pseudomonas aeruginosa transcriptional regulator PA2196 bound to its operator DNA.
Resolution	2.9 Å
Binding residue (original residue number in PDB)	G29 K41 Y45 S50 K51
Binding residue (residue number reindexed from 1)	G23 K35 Y39 S44 K45

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000976	transcription cis-regulatory region binding
GO:0003677	DNA binding

	Biological Process
GO:0009889	regulation of biosynthetic process
GO:0080090	regulation of primary metabolic process

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4l62, PDBe:4l62, PDBj:4l62
PDBsum	4l62
PubMed	24070609
UniProt	Q9I1S1

[Back to BioLiP]