Structure of PDB 4ivz Chain F Binding Site BS02

Receptor Information
>4ivz Chain F (length=76) Species: 211595 (Enterobacter sp. RFL1396) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTFISGIERNSRNLTIK
SLELIMKGLEVSDVVFFEMLIKEILK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ivz Structural and Mutagenic Analysis of the RM Controller Protein C.Esp1396I.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		R17 T23 Q24 R35 S39 R43 N44
Binding residue
(residue number reindexed from 1)		R16 T22 Q23 R34 S38 R42 N43
Binding affinityPDBbind-CN: Kd=1.8nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4ivz, PDBe:4ivz, PDBj:4ivz
PDBsum4ivz
PubMed24887147
UniProtQ8GGH0

[Back to BioLiP]