Structure of PDB 4h4l Chain F Binding Site BS02

Receptor Information

>4h4l Chain F (length=143) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168)

TLHKERRIGRLSVLLLLNEAQVEELERDGWKVCLGKVGSMDAHKVIAAIE
TASKKSGVIQSEGYRESHALYHATMEALHGVTRGEMLLGSLLRTVGLRFA
VLRGNPYESEAEGDWIAVSLYGTIGAPIKGLEHETFGVGINHI

Ligand information

• Ligand ID: HIS
• InChI: InChI=1S/C6H9N3O2/c7-5(6(10)11)1-4-2-8-3-9-4/h2-3,5H,1,7H2,(H,8,9)(H,10,11)/p+1/t5-/m0/s1
• InChIKey: HNDVDQJCIGZPNO-YFKPBYRVSA-O
• SMILES:
  OpenEye OEToolkits 1.5.0: c1c([nH+]c[nH]1)CC(C(=O)O)N
  CACTVS 3.341: N[CH](Cc1c[nH]c[nH+]1)C(O)=O
  CACTVS 3.341: N[C@@H](Cc1c[nH]c[nH+]1)C(O)=O
  ACDLabs 10.04: O=C(O)C(N)Cc1cnc[nH+]1
  OpenEye OEToolkits 1.5.0: c1c([nH+]c[nH]1)C[C@@H](C(=O)O)N
• Formula: C6 H10 N3 O2
• Name: HISTIDINE
• PDB chain: 4h4l Chain F Residue 201

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4h4l Alternative binding modes of l-histidine guided by metal ions for the activation of the antiterminator protein HutP of Bacillus subtilis.
• Resolution: 2.5 Å
• Binding residue (original residue number in PDB): R88 R98 I129 G130 A131 H138
• Binding residue (residue number reindexed from 1): R83 R93 I124 G125 A126 H133
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003729 mRNA binding

Biological Process

• GO:0006547 L-histidine metabolic process
• GO:0010628 positive regulation of gene expression

External links

• PDB: RCSB:4h4l, PDBe:4h4l, PDBj:4h4l
• PDBsum: 4h4l
• PubMed: 23748184
• UniProt: P10943|HUTP_BACSU Hut operon positive regulatory protein (Gene Name=hutP)