Structure of PDB 4cn7 Chain F Binding Site BS02

Receptor Information

>4cn7 Chain F (length=80) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

TKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLID
KRQRNRCQYCRYQKCLAMGMKREAVQEERQ

Ligand information

>4cn7 Chain H (length=16) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ctgacctttgacctag

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4cn7 Structural Basis of Natural Promoter Recognition by the Retinoid X Nuclear Receptor.
Resolution	2.34 Å
Binding residue (original residue number in PDB)	E153 G154 R161 R184 N185 Q188 R191 R209
Binding residue (residue number reindexed from 1)	E23 G24 R31 R54 N55 Q58 R61 R79
Binding affinity	PDBbind-CN: Kd=155nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity
GO:0008270	zinc ion binding
GO:0043565	sequence-specific DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4cn7, PDBe:4cn7, PDBj:4cn7
PDBsum	4cn7
PubMed	25645674
UniProt	P19793\|RXRA_HUMAN Retinoic acid receptor RXR-alpha (Gene Name=RXRA)

[Back to BioLiP]