Structure of PDB 3zvk Chain F Binding Site BS02

Receptor Information
>3zvk Chain F (length=78) Species: 42862 (Rickettsia felis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MNKAKIFMNGQSQAVRLPKEFRFSVKEVSVIPLGKGIVLQPLPNSWKDVF
QEMAEISSDDIFPEGRKDLPPQKRKYFE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3zvk Crystal Structure of the DNA-Bound Vapbc2 Antitoxin/Toxin Pair from Rickettsia Felis.
Resolution2.5 Å
Binding residue
(original residue number in PDB)
K5 R16 P18 K19 R22
Binding residue
(residue number reindexed from 1)
K5 R16 P18 K19 R22
Binding affinityPDBbind-CN: Kd=0.11uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:3zvk, PDBe:3zvk, PDBj:3zvk
PDBsum3zvk
PubMed22140099
UniProtQ4UNB3|VAPB2_RICFE Antitoxin VapB2 (Gene Name=vapB2)

[Back to BioLiP]