Structure of PDB 3wtw Chain F Binding Site BS02

Receptor Information
>3wtw Chain F (length=119) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVAKGDVPDGTLVTVMAGN
DENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQV
ATYHRAIAITVDGPREPRR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3wtw A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		R80 K83 R135 R142 R174 R177
Binding residue
(residue number reindexed from 1)		R21 K24 R76 R83 R115 R118
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005524 ATP binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3wtw, PDBe:3wtw, PDBj:3wtw
PDBsum3wtw
PubMed25083921
UniProtQ03347|RUNX1_MOUSE Runt-related transcription factor 1 (Gene Name=Runx1)

[Back to BioLiP]