Structure of PDB 3trz Chain F Binding Site BS02

Receptor Information
>3trz Chain F (length=130) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGF
RSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSEDRCYNCGGLDHHA
KECKLPPQPKKCHFCQSINHMVASCPLKAQ
Ligand information
>3trz Chain Z (length=21) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gggcagggauuuugcccggag
<<<<<.......>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3trz Molecular Basis for Interaction of let-7 MicroRNAs with Lin28.
Resolution2.9 Å
Binding residue
(original residue number in PDB)
K45 W46 F47 N48 V49 R50 M51 F53 F55 D71 F73 H75 Q76 F84 R85 S100 K102 E105 E121
Binding residue
(residue number reindexed from 1)
K11 W12 F13 N14 V15 R16 M17 F19 F21 D37 F39 H41 Q42 F50 R51 S66 K68 E71 E87
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0008270 zinc ion binding

View graph for
Molecular Function
External links
PDB RCSB:3trz, PDBe:3trz, PDBj:3trz
PDBsum3trz
PubMed22078496
UniProtQ8K3Y3|LN28A_MOUSE Protein lin-28 homolog A (Gene Name=Lin28a)

[Back to BioLiP]