Structure of PDB 3fmt Chain F Binding Site BS02

Receptor Information

>3fmt Chain F (length=157) Species: 83333 (Escherichia coli K-12)

MKTIEVDDELYSYIASHTKHIGESRSDILRRMLKFKPVKTIKDKVRAMRE
LLLSDEYAEQKRAVNRFMLLLSTLYSLDAQAFAEATESLHGRTRVYFAAD
EQTLLKNGNQTKPKHVPGTPYWVITNTNTGRKCSMIEHIMQSMQFPAELI
EKVCGTI

Ligand information

>3fmt Chain H (length=21)

ttaaggatcccgccgatcgac

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3fmt Structural insights into the cooperative binding of SeqA to a tandem GATC repeat
• Resolution: 2.983 Å
• Binding residue (original residue number in PDB): G115 R116 R118 Y120 Q134 N150 R155
• Binding residue (residue number reindexed from 1): G91 R92 R94 Y96 Q110 N126 R131

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003688 DNA replication origin binding
• GO:0005515 protein binding
• GO:0010385 double-stranded methylated DNA binding
• GO:0042802 identical protein binding
• GO:0042803 protein homodimerization activity
• GO:0043565 sequence-specific DNA binding
• GO:0044729 hemi-methylated DNA-binding

Biological Process

• GO:0006355 regulation of DNA-templated transcription
• GO:0007062 sister chromatid cohesion
• GO:0008156 negative regulation of DNA replication
• GO:0009314 response to radiation
• GO:0032297 negative regulation of DNA-templated DNA replication initiation
• GO:0090143 nucleoid organization

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0032991 protein-containing complex
• GO:1990097 SeqA-DNA complex

External links

• PDB: RCSB:3fmt, PDBe:3fmt, PDBj:3fmt
• PDBsum: 3fmt
• PubMed: 19304745
• UniProt: P0AFY8|SEQA_ECOLI Negative modulator of initiation of replication (Gene Name=seqA)