Structure of PDB 3coa Chain F Binding Site BS02

Receptor Information

>3coa Chain F (length=87) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSN
SSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNP

Ligand information

>3coa Chain E (length=16) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

caagcaaaacaaacca

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3coa Structural Basis for DNA Recognition by FoxO1 and Its Regulation by Posttranslational Modification.
Resolution	2.2 Å
Binding residue (original residue number in PDB)	S164 Y165 N211 H215 G232
Binding residue (residue number reindexed from 1)	S10 Y11 N57 H61 G78
Binding affinity	PDBbind-CN: Kd=128nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity
GO:0043565	sequence-specific DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:3coa, PDBe:3coa, PDBj:3coa
PDBsum	3coa
PubMed	18786403
UniProt	Q12778\|FOXO1_HUMAN Forkhead box protein O1 (Gene Name=FOXO1)

[Back to BioLiP]