Structure of PDB 3bsu Chain F Binding Site BS02

Receptor Information

>3bsu Chain F (length=49) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SHMFYAVRRGRKTGVFLTWNECRAQVDRFPAARFKKFATEDEAWAFVRK

Ligand information

>3bsu Chain J (length=12) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gaatcaggugtc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3bsu Specific recognition of RNA/DNA hybrid and enhancement of human RNase H1 activity by HBD.
Resolution	2.1 Å
Binding residue (original residue number in PDB)	Y29 W43 F58 K60
Binding residue (residue number reindexed from 1)	Y5 W19 F34 K36
Binding affinity	PDBbind-CN: Kd=0.2uM

Enzymatic activity

Enzyme Commision number

3.1.26.4: ribonuclease H.

External links

PDB	RCSB:3bsu, PDBe:3bsu, PDBj:3bsu
PDBsum	3bsu
PubMed	18337749
UniProt	O60930\|RNH1_HUMAN Ribonuclease H1 (Gene Name=RNASEH1)

[Back to BioLiP]