Structure of PDB 3b6f Chain F Binding Site BS02

Receptor Information
>3b6f Chain F (length=87) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENV
IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Ligand information
>3b6f Chain J (length=147) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagatactaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagctggattccagctgaacatgccttttgatgga
gcagtttccaaatacacttttggtagtatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3b6f Site selectivity of platinum anticancer therapeutics
Resolution3.45 Å
Binding residue
(original residue number in PDB)		R17 H18 P32 R36 R45
Binding residue
(residue number reindexed from 1)		R2 H3 P17 R21 R30
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006334 nucleosome assembly
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3b6f, PDBe:3b6f, PDBj:3b6f
PDBsum3b6f
PubMed18157123
UniProtP62799|H4_XENLA Histone H4

[Back to BioLiP]