Structure of PDB 2z3f Chain F Binding Site BS02

Receptor Information

>2z3f Chain F (length=159) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

IVNILSVNVLNNPAKFSDPYKFEITFECLEPLKSDLEWKLTYVGSATSQS
YDQILDTLLVGPIPIGINKFVFEADPPNIDLLPQLSDVLGVTVILLSCAY
EDNEFVRVGYYVNNEMEGLNLQEMDDAEIKKVKVDISKVWRSILAEKPRV
TRFNIQWDN

Ligand information

>2z3f Chain R (length=5) Species: 4896 (Schizosaccharomyces pombe) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PTPVY

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2z3f Crystal Structures of Fission Yeast Histone Chaperone Asf1 Complexed with the Hip1 B-domain or the Cac2 C Terminus
Resolution	2.7 Å
Binding residue (original residue number in PDB)	S8 V9
Binding residue (residue number reindexed from 1)	S6 V7

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006325	chromatin organization

	Cellular Component
GO:0005634	nucleus

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2z3f, PDBe:2z3f, PDBj:2z3f
PDBsum	2z3f
PubMed	18334479
UniProt	O74515\|ASF1_SCHPO Histone chaperone cia1 (Gene Name=cia1)

[Back to BioLiP]