Structure of PDB 2r0q Chain F Binding Site BS02

Receptor Information
>2r0q Chain F (length=191) Species: 1280 (Staphylococcus aureus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MIIGYARVSSLDQNLERQLENLKTFGAEKIFTEKNRPILQKALNFVRMGD
RFIVESIDRLGRNYNEVIHTVNYLKDKEVQLMITSLPMMNEVIGNPLLDK
FMKDLIIQILAMVSEQERNESKQAQGIQVAKEKGVYKGRPLLYSPNAKDP
QKRVIYHRVVEMLEEGQAISKIAKEVNITRQTVYRIKHDNG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2r0q Architecture of a serine recombinase-DNA regulatory complex.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		G147 R148 L150 L151 T188 T191 R194
Binding residue
(residue number reindexed from 1)		G138 R139 L141 L142 T179 T182 R185
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000150 DNA strand exchange activity
GO:0003677 DNA binding
Biological Process
GO:0006310 DNA recombination
GO:0015074 DNA integration
GO:0032196 transposition

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2r0q, PDBe:2r0q, PDBj:2r0q
PDBsum2r0q
PubMed18439894
UniProtP20384|BIN3_STAAU Putative transposon Tn552 DNA-invertase bin3 (Gene Name=bin3)

[Back to BioLiP]