Structure of PDB 2qkk Chain F Binding Site BS02

Receptor Information
>2qkk Chain F (length=152) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHMGDFVVVYTDGCCSSNRRRPRAGIGVYWGPGHPLNVGIRLPGRQTNQ
RAEIHAACKAIEQAKTQNINKLVLYTNSMFTINGITNWVQGWKKNGWKTS
AGKEVINKEDFVALERLTQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQ
SE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2qkk Structure of Human RNase H1 Complexed with an RNA/DNA Hybrid: Insight into HIV Reverse Transcription
Resolution3.2 Å
Binding residue
(original residue number in PDB)		N151 R179 T181 N182 Q183 F213 W221 T232 S233 V238 I239 N240
Binding residue
(residue number reindexed from 1)		N19 R46 T48 N49 Q50 F80 W88 T99 S100 V105 I106 N107
Enzymatic activity
Enzyme Commision number 3.1.26.4: ribonuclease H.
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0004523 RNA-DNA hybrid ribonuclease activity

View graph for
Molecular Function
External links
PDB RCSB:2qkk, PDBe:2qkk, PDBj:2qkk
PDBsum2qkk
PubMed17964265
UniProtO60930|RNH1_HUMAN Ribonuclease H1 (Gene Name=RNASEH1)

[Back to BioLiP]