Structure of PDB 2c5r Chain F Binding Site BS02

Receptor Information
>2c5r Chain F (length=63) Species: 10756 (Salasvirus phi29) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NLSACEVAVLDLYEQSNIRIPSDIIEDLVNQRLQSEQEVLNYIETQRTYW
KLENQKKLYRGSL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2c5r Structural Basis for Membrane Anchorage of Viral Phi 29 DNA During Replication.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		K116 L117 Q120
Binding residue
(residue number reindexed from 1)		K51 L52 Q55
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0039693 viral DNA genome replication

View graph for
Biological Process
External links
PDB RCSB:2c5r, PDBe:2c5r, PDBj:2c5r
PDBsum2c5r
PubMed16275651
UniProtP16517|GP167_BPPH2 DNA replication protein 16.7 (Gene Name=16.7)

[Back to BioLiP]