Structure of PDB 2bsq Chain F Binding Site BS02

Receptor Information

>2bsq Chain F (length=64) Species: 485 (Neisseria gonorrhoeae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ASVVIRNLSEATHNAIKFRARAAGRSTEAEIRLILDNIAKAQQTVRLGSM
LASIGQEIGGVELE

Ligand information

>2bsq Chain J (length=36) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

caaatgctatcaaaauaaaaaaaatgatagcaatct

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2bsq Structure of Fitab from Neisseria Gonorrhoeae Bound to DNA Reveals a Tetramer of Toxin-Antitoxin Heterodimers Containing Pin Domains and Ribbon-Helix-Helix Motifs.
Resolution	3.0 Å
Binding residue (original residue number in PDB)	R22 S27 T28 E29 R33
Binding residue (residue number reindexed from 1)	R21 S26 T27 E28 R32
Binding affinity	PDBbind-CN: Kd=4.5nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0005515	protein binding
GO:0042803	protein homodimerization activity
GO:0043565	sequence-specific DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0044001	migration in host

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2bsq, PDBe:2bsq, PDBj:2bsq
PDBsum	2bsq
PubMed	16982615
UniProt	Q5F881\|FITA_NEIG1 Antitoxin FitA (Gene Name=fitA)

[Back to BioLiP]