Structure of PDB 1vtl Chain F Binding Site BS02

Receptor Information

>1vtl Chain F (length=186) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DLSKHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIM
RIREPKTTALIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAKFKD
FKIQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKIVL
LIFVSGKIVITGAKMRDETYKAFENIYPVLSEFRKI

Ligand information

>1vtl Chain D (length=14) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tgcccttttatagc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1vtl Co-Crystal Structure of TBP Recognizing the Minor Groove of a TATA Element
Resolution	2.25 Å
Binding residue (original residue number in PDB)	Q26 N27 R56 F57 R63 T70 L72 T82 F148 P149 F165 S167 K169 V171
Binding residue (residue number reindexed from 1)	Q14 N15 R44 F45 R51 T58 L60 T70 F136 P137 F153 S155 K157 V159

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0005515	protein binding

	Biological Process
GO:0006352	DNA-templated transcription initiation

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1vtl, PDBe:1vtl, PDBj:1vtl
PDBsum	1vtl
PubMed	8413605
UniProt	P28147\|TBP1_ARATH TATA-box-binding protein 1 (Gene Name=TBP1)

[Back to BioLiP]