Structure of PDB 1q4q Chain F Binding Site BS02

Receptor Information
>1q4q Chain F (length=94) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YFPQYPEYAIETARLRTFEAWPRNLKQKPHQLAEAGFFYTGVGDRVRCFS
CGGGLMDWNDNDEPWEQHALWLSQCRFVKLMKGQLYIDTVAAKP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1q4q Molecular mechanism of Reaper-Grim-Hid-mediated suppression of DIAP1-dependent Dronc ubiquitination
Resolution2.1 Å
Binding residue
(original residue number in PDB)
Y220 R260 R262 G269 L270 M271 D272 W273 N274 W286
Binding residue
(residue number reindexed from 1)
Y5 R45 R47 G54 L55 M56 D57 W58 N59 W71
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
External links
PDB RCSB:1q4q, PDBe:1q4q, PDBj:1q4q
PDBsum1q4q
PubMed14517550
UniProtQ24306|DIAP1_DROME Death-associated inhibitor of apoptosis 1 (Gene Name=Diap1)

[Back to BioLiP]