Structure of PDB 1le5 Chain F Binding Site BS02

Receptor Information

>1le5 Chain F (length=313) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNY
VGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGVCTVTAGPKDMVVGFANL
GILHVTKKKVFETLEARMTEACIRGYNPGLLVHSDLAYLQAEGGGDRQLT
DREKEIIRQAAVQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAI
YDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEE
NGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDL
ETSEPKPFLYYPE

Ligand information

>1le5 Chain H (length=12) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaggaatttccc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1le5 The X-ray crystal structure of the NF-kB p50/p65 heterodimer bound to the Interferon beta-kB site
Resolution	2.75 Å
Binding residue (original residue number in PDB)	Y57 C59 E60 T143 K144 P243 Q274 K275 R305 Q306
Binding residue (residue number reindexed from 1)	Y20 C22 E23 T106 K107 P206 Q237 K238 R268 Q269

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1le5, PDBe:1le5, PDBj:1le5
PDBsum	1le5
PubMed	11970948
UniProt	P25799\|NFKB1_MOUSE Nuclear factor NF-kappa-B p105 subunit (Gene Name=Nfkb1)

[Back to BioLiP]