Structure of PDB 1aiy Chain F Binding Site BS02

Receptor Information
>1aiy Chain F (length=30) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Ligand information
>1aiy Chain E (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GIVEQCCTSICSLYQLENYCN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1aiy Solution structures of the R6 human insulin hexamer.
ResolutionN/A
Binding residue
(original residue number in PDB)		C7 L11 C19 G23 F24 Y26 P28
Binding residue
(residue number reindexed from 1)		C7 L11 C19 G23 F24 Y26 P28
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1aiy, PDBe:1aiy, PDBj:1aiy
PDBsum1aiy
PubMed9235985
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]