Structure of PDB 8qkt Chain EEE Binding Site BS02

Receptor Information
>8qkt Chain EEE (length=97) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Ligand information
>8qkt Chain JJJ (length=167) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcttttttttttcacaatcccggtgccgaggccgctcaattggtcgtag
acagctctagcaccgcttaaacgcacgtacggattccgtacgtgcgttta
agcggtgctagagctgtctacgaccaattgagcggcctcggcaccgggat
tgtgaaaaaaaaaagat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8qkt Engineering nucleosomes for generating diverse chromatin assemblies.
Resolution3.261 Å
Binding residue
(original residue number in PDB)		R42 T45 R72 R83 F84 Q85 R116 V117 T118
Binding residue
(residue number reindexed from 1)		R5 T8 R35 R46 F47 Q48 R79 V80 T81
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8qkt, PDBe:8qkt, PDBj:8qkt
PDBsum8qkt
PubMed
UniProtP68431|H31_HUMAN Histone H3.1 (Gene Name=H3C1)

[Back to BioLiP]