Structure of PDB 6wat Chain EA Binding Site BS02

Receptor Information
>6wat Chain EA (length=60) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RPRLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQFEDDSQFLVLWKD
ISPAALPGEE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6wat Structural basis for histone variant H3tK27me3 recognition by PHF1 and PHF19.
Resolution1.8 Å
Binding residue
(original residue number in PDB)
D36 L48 T50 P80 A81 A82
Binding residue
(residue number reindexed from 1)
D9 L21 T23 P53 A54 A55
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6wat, PDBe:6wat, PDBj:6wat
PDBsum6wat
PubMed32869745
UniProtO43189|PHF1_HUMAN PHD finger protein 1 (Gene Name=PHF1)

[Back to BioLiP]