Structure of PDB 7r81 Chain E2 Binding Site BS02

Receptor Information
>7r81 Chain E2 (length=224) Species: 5141 (Neurospora crassa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ISKRRKFVADGVFYAELNEFFQRELAEEGYSGVEVRVTPTVTDIIIRATH
TQEVLGEQGRRIRELTSLIQKRFKFPENSVSLYAAKVQNRGLSAVAQCES
LRYKLLNGLAVRRACYGVLRFIMESGAKGCEVVVSGKLRAARAKSMKFTD
GFMIHSGQPAKDFIDSATRHVLLRQGVLGIKVKIMRGSDPEGKSGPQKSL
PDAVTIIEPKEEQPVTQPISQDYG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7r81 Structure of the translating Neurospora ribosome arrested by cycloheximide
Resolution2.7 Å
Binding residue
(original residue number in PDB)		R120 K151
Binding residue
(residue number reindexed from 1)		R113 K144
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0003906 DNA-(apurinic or apyrimidinic site) endonuclease activity
Biological Process
GO:0000054 ribosomal subunit export from nucleus
GO:0000056 ribosomal small subunit export from nucleus
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0070651 nonfunctional rRNA decay
GO:1990145 maintenance of translational fidelity
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022626 cytosolic ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0030688 preribosome, small subunit precursor
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7r81, PDBe:7r81, PDBj:7r81
PDBsum7r81
PubMed34815343
UniProtQ7RV52

[Back to BioLiP]