Structure of PDB 8ybk Chain E Binding Site BS02

Receptor Information
>8ybk Chain E (length=79) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
STELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACKAYLVGLFED
TNLCAIHAKRVTIMPKDIQLARRIRGERA
Ligand information
>8ybk Chain J (length=114) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acgtgcctggagactagggagtaatccccttggcggttaaaacgcggggg
acagcgcgtacgtgcgtttaagcggtgctagagctgtctacgaccaattg
agcggcctcggcac
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ybk Cryo-EM structure and biochemical analyses of the nucleosome containing the cancer-associated histone H3 mutation E97K.
Resolution2.69 Å
Binding residue
(original residue number in PDB)
R72 R83 V117 T118
Binding residue
(residue number reindexed from 1)
R16 R27 V61 T62
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0045296 cadherin binding
Biological Process
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
GO:0010467 gene expression
GO:0032200 telomere organization
GO:0040029 epigenetic regulation of gene expression
Cellular Component
GO:0000786 nucleosome
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0016020 membrane
GO:0032991 protein-containing complex
GO:0070062 extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8ybk, PDBe:8ybk, PDBj:8ybk
PDBsum8ybk
PubMed38972377
UniProtP68431|H31_HUMAN Histone H3.1 (Gene Name=H3C1)

[Back to BioLiP]