Structure of PDB 8x6f Chain E Binding Site BS02

Receptor Information
>8x6f Chain E (length=271) Species: 1280 (Staphylococcus aureus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DPVRMYLKEIGRVNLLSAQEEIELAKRIEQGDEVAKSRLAEANLRLVVSI
AKRYVGRGMLFLDLIQEGNMGLIKAVEKFDFNKGFKFSTYATWWIRQAIT
RAIADQARTIRIPVHMVETINKLIRVQRQLLQDLGRDPAPEEIGEEMDLP
AEKVREVLKIAQEPVSLETPIGEEDDSHLGDFIEDQEAQSPSDHAAYELL
KEQLEDVLDTLTDREENVLRLRFGLDDGRTRTLEEVGKVFGVTRERIRQI
EAKALRKLRHPSRSKRLKDFM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8x6f Structural basis of promoter recognition by Staphylococcus aureus RNA polymerase
Resolution3.7 Å
Binding residue
(original residue number in PDB)		R153 Q193 R318 T328 L329 R340 E341
Binding residue
(residue number reindexed from 1)		R57 Q97 R222 T232 L233 R244 E245
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0016987 sigma factor activity
Biological Process
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription
GO:0010468 regulation of gene expression
GO:2000142 regulation of DNA-templated transcription initiation
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8x6f, PDBe:8x6f, PDBj:8x6f
PDBsum8x6f
PubMed38844782
UniProtP0A0J0|SIGA_STAA8 RNA polymerase sigma factor SigA (Gene Name=sigA)

[Back to BioLiP]