Structure of PDB 8x2j Chain E Binding Site BS02

Receptor Information

>8x2j Chain E (length=164) Species: 324602 (Chloroflexus aurantiacus J-10-fl)

CHQDMYDQQKYTTYEPSSFFADGRSSRPNVPGTTPFEVVKTDEFLYTGLI
DGQEVDAMPFPVTKDLLLRGQLKYNIYCAVCHGEAGYGASMVAERGGIVP
ANFHQQRLREAPLSHFFVVITNGVYRGDPENGGYQSMYGYASRITPEDRW
AIAAYIRALQLSQN

Ligand information

• Ligand ID: HEC
• InChI: InChI=1S/C34H34N4O4.Fe/c1-7-21-17(3)25-13-26-19(5)23(9-11-33(39)40)31(37-26)16-32-24(10-12-34(41)42)20(6)28(38-32)15-30-22(8-2)18(4)27(36-30)14-29(21)35-25;/h7-8,13-16H,9-12H2,1-6H3,(H,39,40)(H,41,42);/q-4;+4/b21-7?,22-8?,26-13-,29-14-,30-15-,31-16-;
• InChIKey: HXQIYSLZKNYNMH-LJNAALQVSA-N
• SMILES:
  ACDLabs 10.04: O=C(O)CCC1=C(C2=CC6=C(C(=C/C)\C5=CC4=C(C(\C3=Cc7c(c(c8C=C1N2[Fe](N34)(N56)n78)CCC(=O)O)C)=C/C)C)C)C
  OpenEye OEToolkits 1.5.0: CC=C1C(=C2C=C3C(=CC)C(=C4N3[Fe]56N2C1=Cc7n5c(c(c7C)CCC(=O)O)C=C8N6C(=C4)C(=C8CCC(=O)O)C)C)C
  CACTVS 3.341: C\C=C1/C(=C2C=C3N4C(=Cc5n6c(C=C7N8C(=C(C)\C7=C/C)C=C1N2[Fe@@]468)c(C)c5CCC(O)=O)C(=C3C)CCC(O)=O)C
  CACTVS 3.341: CC=C1C(=C2C=C3N4C(=Cc5n6c(C=C7N8C(=C(C)C7=CC)C=C1N2[Fe]468)c(C)c5CCC(O)=O)C(=C3C)CCC(O)=O)C
• Formula: C34 H34 Fe N4 O4
• Name: HEME C
• PDB chain: 8x2j Chain E Residue 301

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8x2j Cryo-EM structure of HQNO-bound Alternative Complex III from the anoxygenic phototrophic bacterium Chloroflexus aurantiacus.
• Resolution: 2.7 Å
• Binding residue (original residue number in PDB): C103 C106 H107 I123 P125 F128 R132 L133 F141 V144 I145 Y150 S161 M162 Y165
• Binding residue (residue number reindexed from 1): C78 C81 H82 I98 P100 F103 R107 L108 F116 V119 I120 Y125 S136 M137 Y140
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

External links

• PDB: RCSB:8x2j, PDBe:8x2j, PDBj:8x2j
• PDBsum: 8x2j
• PubMed: 38299372
• UniProt: A9WEV6