Structure of PDB 8tj5 Chain E Binding Site BS02

Receptor Information
>8tj5 Chain E (length=217) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QIQEQVLKCKESWDPNTTKTKLRAFVYNKVNETEAILYTKPGHVLQEEWD
QAMEKKPSPQTIPIQIYGFEGLNQRNQVQTENVAQARIILNHILEKSTQL
QQKHELDTASRILKAQSRNVEIEKRILKLGTQLATLKEEKMWSQFQTLLQ
RSEDPAGLGKTNELWARLAILKERAKNISSQINKIVEILTNQQRGITYLN
EVLEKDAAIVKKYKNKT
Ligand information
>8tj5 Chain k (length=13) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AAAAAAAAAAAAA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8tj5 Implications of a multiscale structure of the yeast nuclear pore complex.
Resolution6.6 Å
Binding residue
(original residue number in PDB)		T366 E367 A370 R373
Binding residue
(residue number reindexed from 1)		T80 E81 A84 R87
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0017056 structural constituent of nuclear pore
GO:0042802 identical protein binding
Biological Process
GO:0006606 protein import into nucleus
GO:0006607 NLS-bearing protein import into nucleus
GO:0006913 nucleocytoplasmic transport
GO:0006999 nuclear pore organization
GO:0015031 protein transport
GO:0036228 protein localization to nuclear inner membrane
GO:0051028 mRNA transport
Cellular Component
GO:0005634 nucleus
GO:0005635 nuclear envelope
GO:0005643 nuclear pore
GO:0016020 membrane
GO:0031965 nuclear membrane
GO:0044613 nuclear pore central transport channel

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8tj5, PDBe:8tj5, PDBj:8tj5
PDBsum8tj5
PubMed37738963
UniProtP48837|NUP57_YEAST Nucleoporin NUP57 (Gene Name=NUP57)

[Back to BioLiP]